PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00084.170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Whirly
Protein Properties Length: 324aa    MW: 36396.7 Da    PI: 9.9022
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00084.170genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly217.81e-67992371139
          Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalk 95 
                     s+yk+kaal+v++++p+f aldsg++k+ r+G++ll++a+a+a r+ydW++kq+f+ls+te+++l++l++k+sceffhdp +++s+eGk+rk+lk
  Jcr4S00084.170  99 SIYKGKAALTVQPRAPEFAALDSGAFKVAREGFMLLQFAPAAAARQYDWSRKQVFSLSVTEIGTLISLGAKDSCEFFHDPNKGKSDEGKIRKVLK 193
                     7********************************************************************************************** PP

          Whirly  96 vePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                     vePlpdGsG+f+nlsv+n+ ++ +es+++Pv+kae++vl+++++
  Jcr4S00084.170 194 VEPLPDGSGHFFNLSVQNKALNMDESIYIPVTKAEYTVLITAFN 237
                     *****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.109.2E-6988238IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544473.22E-6192239IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.9E-61100234IPR013742Plant transcription factor
SuperFamilySSF544472.04E-7278317IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MLQLNLLSPQ LSTRNPKVFA LDSVSSKKSL KLLKASEFNP KIYTLSPTKT SAKTRLAVKC  60
RQSELYEKQR FNSSRSSSTD YSFAPGVGES PPKVFVSHSI YKGKAALTVQ PRAPEFAALD  120
SGAFKVAREG FMLLQFAPAA AARQYDWSRK QVFSLSVTEI GTLISLGAKD SCEFFHDPNK  180
GKSDEGKIRK VLKVEPLPDG SGHFFNLSVQ NKALNMDESI YIPVTKAEYT VLITAFNFDF  240
LPLGVNEEII KRALGDEPII IMSVNEEIIK RNIIIRGQYI LPYLLGWNTF ANSIRPDENS  300
RGNDANPRYG GDYEWNRFVD RRMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-1018831632219p24: plant transcriptional regulator PBF-2
1l3a_B1e-1018831632219p24: plant transcriptional regulator PBF-2
1l3a_C1e-1018831632219p24: plant transcriptional regulator PBF-2
1l3a_D1e-1018831632219p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012091932.10.0PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotQ9M9S31e-112WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA0A067JBQ00.0A0A067JBQ0_JATCU; Uncharacterized protein
STRINGPOPTR_0008s14840.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF64163251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-113ssDNA-binding transcriptional regulator